PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009620409.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 321aa    MW: 36481.1 Da    PI: 7.9389
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009620409.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM177.92.8e-5551311129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeel+++yL++kv++ ++++ ++i++vd++k+ePwdLp+k++ +ekewyfFs +d+ky+tg r+nrat++gyWk+tgkdke+++ 
  XP_009620409.1   5 LPPGFRFHPTDEELITFYLTNKVSDFSFTA-RAIADVDLNKCEPWDLPAKASMGEKEWYFFSLKDRKYPTGLRTNRATEAGYWKTTGKDKEIFR- 97 
                     79*************************999.89***************999999****************************************. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrle 129
                     +g lvg+kktLvfy+grapkgekt+Wv+heyrle
  XP_009620409.1  98 GGVLVGMKKTLVFYRGRAPKGEKTNWVIHEYRLE 131
                     ********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.07E-633151IPR003441NAC domain
PROSITE profilePS5100559.3515151IPR003441NAC domain
PfamPF023651.9E-276130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MEEKLPPGFR FHPTDEELIT FYLTNKVSDF SFTARAIADV DLNKCEPWDL PAKASMGEKE  60
WYFFSLKDRK YPTGLRTNRA TEAGYWKTTG KDKEIFRGGV LVGMKKTLVF YRGRAPKGEK  120
TNWVIHEYRL ETRLGFKPSK EEWVVCRVFQ KSSTVKKPQP TSSSPQSLES PNCDTNTIIT  180
NELGDIELPI NYNCLATPSI GMISNNISLH NYNNENMNMN LNMNLASSLL NSSNLSSVNS  240
LLFRALQLRG YQPREATTTT NDYSFMPPIQ GNISQFANDN HFSSNFVANI GAIPSSSMVF  300
DNSVQQQQTQ EQPYKLDSNI W
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-57515717171NO APICAL MERISTEM PROTEIN
1ut4_B4e-57515717171NO APICAL MERISTEM PROTEIN
1ut7_A4e-57515717171NO APICAL MERISTEM PROTEIN
1ut7_B4e-57515717171NO APICAL MERISTEM PROTEIN
4dul_A4e-57515717171NAC domain-containing protein 19
4dul_B4e-57515717171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00364DAPTransfer from AT3G18400Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009620409.10.0PREDICTED: NAC domain-containing protein 100
RefseqXP_016485595.10.0PREDICTED: NAC domain-containing protein 100-like
SwissprotQ9FLJ22e-84NC100_ARATH; NAC domain-containing protein 100
TrEMBLM1A3A81e-153M1A3A8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000137531e-152(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15224279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.17e-97NAC domain containing protein 58